Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPTE Peptide - C-terminal region

TPTE Peptide - C-terminal region

Product Specifications

UniProt

P56180

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPTE Rabbit Polyclonal Antibody (orb575545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ADD1 (Ser726) Antibody
E18-3276-1 50 µg - 50 µL

Phospho-ADD1 (Ser726) Antibody

Sign In for Pricing
View Details
Epha7 (NM_134331) Rat Tagged ORF Clone Lentiviral Particle
RR212203L4V 200 µL

Epha7 (NM_134331) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TLK2 CRISPR Activation Plasmid (h)
sc-405426-ACT 20 µg

TLK2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MCDB 153 Medium w/ Trace elements, L-Glutamine and HEPES buffer w/o Sodium bicarbonate
AT1135-01 1 L

MCDB 153 Medium w/ Trace elements, L-Glutamine and HEPES buffer w/o Sodium bicarbonate

Sign In for Pricing
View Details
MCDB 153 Medium w/ Trace elements, L-Glutamine and HEPES buffer w/o Sodium bicarbonate
AT1135-02 5 L

MCDB 153 Medium w/ Trace elements, L-Glutamine and HEPES buffer w/o Sodium bicarbonate

Sign In for Pricing
View Details
MCDB 153 Medium w/ Trace elements, L-Glutamine and HEPES buffer w/o Sodium bicarbonate
AT1135-03 10x 1 L

MCDB 153 Medium w/ Trace elements, L-Glutamine and HEPES buffer w/o Sodium bicarbonate

Sign In for Pricing
View Details