Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPTE Peptide - C-terminal region

TPTE Peptide - C-terminal region

Product Specifications

UniProt

P56180

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPTE Rabbit Polyclonal Antibody (orb575545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFYSNLPTYYDNCSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC zeta (PRKCZ) Human Gene Knockout Kit (CRISPR)
KN400438 1 Kit

PKC zeta (PRKCZ) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PACAP 27 amide (Human, Rat, Ovine) - FAM Labeled
FG-052-02A 1 nmol

PACAP 27 amide (Human, Rat, Ovine) - FAM Labeled

Sign In for Pricing
View Details
MIRacle™ hsa-miR-3190-3p miRNA Agomir/Antagomir
AM1246 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-3190-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
GIT2 CRISPR/Cas9 KO Plasmid (m2)
sc-424063-KO-2 20 µg

GIT2 CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
SSU72 Antibody
MBS9524360-01 0.04 mL

SSU72 Antibody

Sign In for Pricing
View Details
SSU72 Antibody
MBS9524360-02 0.1 mL

SSU72 Antibody

Sign In for Pricing
View Details