Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILF2 Peptide - N-terminal region

ILF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NF45, PRO3063

UniProt

Q12905

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ILF2 Rabbit Polyclonal Antibody (orb575599) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004506

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PA2GC rabbit pAb
ES14283-01 50 µL

PA2GC rabbit pAb

Sign In for Pricing
View Details
PA2GC rabbit pAb
ES14283-02 100 µL

PA2GC rabbit pAb

Sign In for Pricing
View Details
Tmem123 Rat shRNA Plasmid (Locus ID 363013)
TL702325 1 Kit

Tmem123 Rat shRNA Plasmid (Locus ID 363013)

Sign In for Pricing
View Details
GCSH polyclonal antibody
orb641364-01 50 μL

GCSH polyclonal antibody

Sign In for Pricing
View Details
GCSH polyclonal antibody
orb641364-02 100 µL

GCSH polyclonal antibody

Sign In for Pricing
View Details
GCSH polyclonal antibody
orb641364-03 200 µL

GCSH polyclonal antibody

Sign In for Pricing
View Details