ZNF607 Peptide - N-terminal region
ZNF607 Peptide - N-terminal region
Product Specifications
UniProt
Q96SK3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF607 Rabbit Polyclonal Antibody (orb575785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKPYKCKECGKAFSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal LEMD2 Antibody [DyLight 594]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-82103DL594 0.1 mL
Rabbit Polyclonal LEMD2 Antibody [DyLight 594]
Sign In for Pricing
View Details 
MBS2090780-01 0.1 mL
Biotin-Linked Monoclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
Sign In for Pricing
View Details MBS2090780-02 0.2 mL
Biotin-Linked Monoclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
Sign In for Pricing
View Details MBS2090780-03 0.5 mL
Biotin-Linked Monoclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
Sign In for Pricing
View Details MBS2090780-04 1 mL
Biotin-Linked Monoclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
Sign In for Pricing
View Details MBS2090780-05 5 mL
Biotin-Linked Monoclonal Antibody to Cluster Of Differentiation 40 Ligand (CD40L)
Sign In for Pricing
View Details