Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF607 Peptide - N-terminal region

ZNF607 Peptide - N-terminal region

Product Specifications

UniProt

Q96SK3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF607 Rabbit Polyclonal Antibody (orb575785) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKPYKCKECGKAFSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl m-nitrobenzoate 95%
E13090 100 g

Ethyl m-nitrobenzoate 95%

Sign In for Pricing
View Details
ORF140 Chemi-Luminescent ELISA Kit (Pig) (OKCD03581)
OKCD03581 96 Well

ORF140 Chemi-Luminescent ELISA Kit (Pig) (OKCD03581)

Sign In for Pricing
View Details
DYT15 sgRNA CRISPR Lentivector set (Human)
K0646301 3x 1.0 µg

DYT15 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Wolbachia sp. subsp. Brugia malayi Aspartate--tRNA ligase (aspS), partial
MBS1474010 Inquire

Recombinant Wolbachia sp. subsp. Brugia malayi Aspartate--tRNA ligase (aspS), partial

Sign In for Pricing
View Details
C1orf50 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-15068R-BF647 100 µL

C1orf50 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
SLC19A1 Polyclonal Conjugated Antibody
orb1628423 100 µL

SLC19A1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details