ZNF195 Peptide - N-terminal region
ZNF195 Peptide - N-terminal region
Product Specifications
UniProt
O14628
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF195 Rabbit Polyclonal Antibody (orb576631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Prealbumin Recombinant Rabbit Monoclonal Antibody [JM11-43]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82bf0/imageurl/et1703-83.webp)
ET1703-83 100 µL
Prealbumin Recombinant Rabbit Monoclonal Antibody [JM11-43]
Sign In for Pricing
View Details 
![IQGAP2 Rabbit Monoclonal Antibody [Clone ID: 23GB4020]](https://cdn.genprice.uk/products/937/6868c300994c49e6dc3ececd/imageurl/ta424901.webp)
TA424901 100 µL
IQGAP2 Rabbit Monoclonal Antibody [Clone ID: 23GB4020]
Sign In for Pricing
View Details