ZNF195 Peptide - N-terminal region
ZNF195 Peptide - N-terminal region
Product Specifications
UniProt
O14628
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF195 Rabbit Polyclonal Antibody (orb576631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682843-100 1x 100 µL
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HP218647 200 Reactions
KRTAP11-1 Human qPCR Primer Pair (NM_175858)
Sign In for Pricing
View Details 
E-BC-K097-M 96 T (80 samples)
Total Glutathione (T-GSH) /Oxidized Glutathione (GSSG) Colorimetric Assay Kit
Sign In for Pricing
View Details