Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF284 Peptide - N-terminal region

ZNF284 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF284L

UniProt

Q2VY69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF284 Rabbit Polyclonal Antibody (orb576674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032902

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C5orf51 shRNA Plasmid
abx967116-01 150 µg

Human C5orf51 shRNA Plasmid

Sign In for Pricing
View Details
Human C5orf51 shRNA Plasmid
abx967116-02 300 µg

Human C5orf51 shRNA Plasmid

Sign In for Pricing
View Details
β-1,3-Gal-TL (C-1)
sc-515662 200 µg/mL

β-1,3-Gal-TL (C-1)

Sign In for Pricing
View Details
Relatlimab Biosimilar - Ultra Low Endotoxin
ICH5117UL-10mg 10 mg (2x 5 mg)

Relatlimab Biosimilar - Ultra Low Endotoxin

Sign In for Pricing
View Details
Guaifenesin EP impurity C
IG176324-01 5 mg

Guaifenesin EP impurity C

Sign In for Pricing
View Details
Guaifenesin EP impurity C
IG176324-02 10 mg

Guaifenesin EP impurity C

Sign In for Pricing
View Details