Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF284 Peptide - N-terminal region

ZNF284 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF284L

UniProt

Q2VY69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF284 Rabbit Polyclonal Antibody (orb576674) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032902

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Feline Leukaemia Virus gp70 Antibody (C11D8) [Alexa Fluor 750]
NB100-65565AF750 0.125 mL

Mouse Monoclonal Feline Leukaemia Virus gp70 Antibody (C11D8) [Alexa Fluor 750]

Sign In for Pricing
View Details
TSC1 Antibody, Biotin conjugated
MBS7050926-01 0.05 mg

TSC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TSC1 Antibody, Biotin conjugated
MBS7050926-02 0.1 mg

TSC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TSC1 Antibody, Biotin conjugated
MBS7050926-03 5x 0.1 mg

TSC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
PTP4A1 Protein Vector (Rat) (pPM-C-HA)
38127026 500 ng

PTP4A1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Human Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit
MBS2606173-01 48 Well

Human Macrophage Inflammatory Protein 3 Alpha (MIP3a/CCL20) ELISA Kit

Sign In for Pricing
View Details