TBX3 Peptide - C-terminal region
TBX3 Peptide - C-terminal region
Product Specifications
UniProt
O15119
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBX3 Rabbit Polyclonal Antibody (orb576807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2158124-01 96 Tests
Tenascin C (TNC) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2158124-02 5x 96 Tests
Tenascin C (TNC) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2158124-03 10x 96 Tests
Tenascin C (TNC) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details 