TBX3 Peptide - C-terminal region
TBX3 Peptide - C-terminal region
Product Specifications
UniProt
O15119
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TBX3 Rabbit Polyclonal Antibody (orb576807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRSSTLSSSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1603824-03 5x 96 Well
Human Placental Protein 13 (PP13) ELISA Kit
Sign In for Pricing
View Details MBS1603824-04 10x 96 Well
Human Placental Protein 13 (PP13) ELISA Kit
Sign In for Pricing
View Details 
RR203509L4 10 µg
MGC93861 (NM_001044281) Rat Tagged Lenti ORF Clone
Sign In for Pricing
View Details