Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF6L Peptide - C-terminal region

TAF6L Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAF65A

UniProt

Q9Y6J9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAF6L Rabbit Polyclonal Antibody (orb576841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006464

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-LOC440700 Plasmid
PVT25396 2 µg

pOTB7-LOC440700 Plasmid

Sign In for Pricing
View Details
CAMK2D (NM_001221) Human Tagged ORF Clone Lentiviral Particle
RC212648L3V 200 µL

CAMK2D (NM_001221) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rac all-trans 3-Hydroxy retinoic acid ethyl ester
sc-488637 1 mg

Rac all-trans 3-Hydroxy retinoic acid ethyl ester

Sign In for Pricing
View Details
Sulfo-Cyanine7.5 NHS ester, 1 mg
16320 1 mg

Sulfo-Cyanine7.5 NHS ester, 1 mg

Sign In for Pricing
View Details
EMP3 Human qPCR Template Standard (NM_001425)
HK202809 1 Kit

EMP3 Human qPCR Template Standard (NM_001425)

Sign In for Pricing
View Details
TTC16 Antibody
E38QA6691 100 µL

TTC16 Antibody

Sign In for Pricing
View Details