Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF6L Peptide - C-terminal region

TAF6L Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAF65A

UniProt

Q9Y6J9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAF6L Rabbit Polyclonal Antibody (orb576841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006464

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NKp80/KLRF1 Antibody (MM0492-7D32) [Alexa Fluor 750]
NBP2-11821AF750 0.1 mL

Mouse Monoclonal NKp80/KLRF1 Antibody (MM0492-7D32) [Alexa Fluor 750]

Sign In for Pricing
View Details
Mouse Monoclonal Maltose Binding Protein Antibody (R3.2) [DyLight 680]
NBP2-76652FR 0.1 mL

Mouse Monoclonal Maltose Binding Protein Antibody (R3.2) [DyLight 680]

Sign In for Pricing
View Details
Anti-ornithine aminotransferase/OAT Antibody Picoband® Fluoro594 Conjugated
A01126-2-Fluoro594 100 µg/Vial

Anti-ornithine aminotransferase/OAT Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Plant Immunoglobulin G2a (IgG2a) ELISA Kit
MBS9381500 Inquire

Plant Immunoglobulin G2a (IgG2a) ELISA Kit

Sign In for Pricing
View Details
Calreticulin (CALR) Magnetic Fluorescence Assay Kit
MBS2157443-01 96 Tests

Calreticulin (CALR) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Calreticulin (CALR) Magnetic Fluorescence Assay Kit
MBS2157443-02 5x 96 Tests

Calreticulin (CALR) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details