ZNF284 Peptide - N-terminal region
ZNF284 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ZNF284L
UniProt
Q2VY69
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF284 Rabbit Polyclonal Antibody (orb576940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001032902
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401828-500 1x 500 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![NABP1 Mouse Monoclonal Antibody [Clone ID: OTI6B10]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908a2f/imageurl/cf811088.webp)
CF811088 100 µg
NABP1 Mouse Monoclonal Antibody [Clone ID: OTI6B10]
Sign In for Pricing
View Details 