Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF284 Peptide - N-terminal region

ZNF284 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF284L

UniProt

Q2VY69

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF284 Rabbit Polyclonal Antibody (orb576940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032902

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUM1 Mouse Monoclonal Antibody [A7C12]
HA601031 100 µL

MUM1 Mouse Monoclonal Antibody [A7C12]

Sign In for Pricing
View Details
R Cadherin (CDH4) (NM_001794) Human Over-expression Lysate
LC400684 20 µg

R Cadherin (CDH4) (NM_001794) Human Over-expression Lysate

Sign In for Pricing
View Details
Phenylseleninic Anhydride
TRC-B398190-1G 1 g

Phenylseleninic Anhydride

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)
PDEH100890-01 20 µg

Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)
PDEH100890-02 100 µg

Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)
PDEH100890-03 500 µg

Recombinant Human PD-L1/B7-H1/CD274 protein (His tag)

Sign In for Pricing
View Details