TOX4 Peptide - C-terminal region
TOX4 Peptide - C-terminal region
Product Specifications
UniProt
B4DPY8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TOX4 Rabbit Polyclonal Antibody (orb576978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH033441-01 10 µg
Recombinant Human DR6/TNFRSF21 Protein (His Tag)
Sign In for Pricing
View Details PKSH033441-02 50 µg
Recombinant Human DR6/TNFRSF21 Protein (His Tag)
Sign In for Pricing
View Details 
LC400664 20 µg
Caveolin 1 (CAV1) (NM_001753) Human Over-expression Lysate
Sign In for Pricing
View Details 
