TOX4 Peptide - C-terminal region
TOX4 Peptide - C-terminal region
Product Specifications
UniProt
B4DPY8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TOX4 Rabbit Polyclonal Antibody (orb576978) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PE/Cyanine5 Anti-Mouse CD45 Antibody[I3/2.3]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d41d8/imageurl08/an00630g.webp)
AN00630G-03 2x 100 Tests
PE/Cyanine5 Anti-Mouse CD45 Antibody[I3/2.3]
Sign In for Pricing
View Details 
BNC942097-100 1x 100 µL
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 