ZNF280D Peptide - N-terminal region
ZNF280D Peptide - N-terminal region
Product Specifications
UniProt
Q6N043
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF280D Rabbit Polyclonal Antibody (orb577054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
IHC, WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RD-NKX6-1-Hu-01 96 Tests
Human NK6 Homeobox Protein 1 (NKX6-1) ELISA Kit
Sign In for Pricing
View Details RD-NKX6-1-Hu-02 48 Tests
Human NK6 Homeobox Protein 1 (NKX6-1) ELISA Kit
Sign In for Pricing
View Details 
5416-AAT 2 Labelings
Buccutite™ Rapid PE-Cy5 Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*
Sign In for Pricing
View Details