Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF280D Peptide - N-terminal region

ZNF280D Peptide - N-terminal region

Product Specifications

UniProt

Q6N043

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF280D Rabbit Polyclonal Antibody (orb577054) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coprs (NM_025556) Mouse Tagged ORF Clone
MG201479 10 µg

Coprs (NM_025556) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
1,4-Cyclohexanedione Monoethylene Acetal
TRC-C987955-25G 25 g

1,4-Cyclohexanedione Monoethylene Acetal

Sign In for Pricing
View Details
LHX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A2]
TA810306BM 100 µL

LHX2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A2]

Sign In for Pricing
View Details
Anti-Arabinogalactan-Protein, AGP (monoclonal, clone LM30)
AS22 4749-1ml 1 mL

Anti-Arabinogalactan-Protein, AGP (monoclonal, clone LM30)

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS641863 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
BLOC1S2 (NM_001001342) Human Over-expression Lysate
LC424327 20 µg

BLOC1S2 (NM_001001342) Human Over-expression Lysate

Sign In for Pricing
View Details