ZSCAN5A Peptide - C-terminal region
ZSCAN5A Peptide - C-terminal region
Product Specifications
UniProt
B4DX98
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZSCAN5A Rabbit Polyclonal Antibody (orb324807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTHPEATSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![FUS2 (NAT6) Mouse Monoclonal Antibody [Clone ID: AT2F4]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc42a/imageurl/am09137pu-n.webp)
AM09137PU-N 100 µL
FUS2 (NAT6) Mouse Monoclonal Antibody [Clone ID: AT2F4]
Sign In for Pricing
View Details 
