Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZSCAN5A Peptide - C-terminal region

ZSCAN5A Peptide - C-terminal region

Product Specifications

UniProt

B4DX98

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZSCAN5A Rabbit Polyclonal Antibody (orb324807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTHPEATSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2'-Thiobis(ethanol)-13C4
TRC-T264842-25MG 25 mg

2,2'-Thiobis(ethanol)-13C4

Sign In for Pricing
View Details
STEAP3 Human Gene Knockout Kit (CRISPR)
KN210595LP 1 Kit

STEAP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
beta-Nicotyrine
TRC-N445000-10MG 10 mg

beta-Nicotyrine

Sign In for Pricing
View Details
TAF9 (NM_003187) Human Over-expression Lysate
LY418840 100 µg

TAF9 (NM_003187) Human Over-expression Lysate

Sign In for Pricing
View Details
BCL2L10 antibody
FNab00844 100 µg

BCL2L10 antibody

Sign In for Pricing
View Details
EGFR pTyr1092 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 15A2]
AM00037PU-N 100 µg

EGFR pTyr1092 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 15A2]

Sign In for Pricing
View Details