Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF780B Peptide - N-terminal region

ZNF780B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF779

UniProt

Q9Y6R6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF780B Rabbit Polyclonal Antibody (orb577372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005851

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS12 (NM_001142537) Human Untagged Clone
SC324875 10 µg

LGALS12 (NM_001142537) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Granzyme G (GZMG) ELISA Kit
abx526137 96 Tests

Mouse Granzyme G (GZMG) ELISA Kit

Sign In for Pricing
View Details
Suc-Ala-Pro-Ala-AMC
MAP-3100-V 5 mg

Suc-Ala-Pro-Ala-AMC

Sign In for Pricing
View Details
Rnf183 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3665002 1.0 µg DNA

Rnf183 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Mouse UEVLD Protein, His (Fc)-Avi-tagged
UEVLD-9874M 50 µg

Recombinant Mouse UEVLD Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
OXCT1 Protein Vector (Human) (pPM-C-HA)
PV029755 500 ng

OXCT1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details