Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF780B Peptide - N-terminal region

ZNF780B Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZNF779

UniProt

Q9Y6R6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF780B Rabbit Polyclonal Antibody (orb577372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005851

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Drd4 shRNA (UAS) - Lentiviral mouse Drd4 shRNA (UAS, iRFP) (25)
GTR15271166 1 Vial

Lentiviral mouse Drd4 shRNA (UAS) - Lentiviral mouse Drd4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Olfr207 AAV Vector (Mouse) (CMV)
32987104 1 µg

Olfr207 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Mouse CD8, clone FK18 (Monoclonal) Antibody
orb624156 1 mL

Mouse CD8, clone FK18 (Monoclonal) Antibody

Sign In for Pricing
View Details
Goat Echinoderm Microtubule Associated Protein Like Protein 2 ELISA Kit
MBS095797 Inquire

Goat Echinoderm Microtubule Associated Protein Like Protein 2 ELISA Kit

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
MBS2167966-01 0.1 mL

HRP-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)
MBS2167966-02 0.2 mL

HRP-Linked Monoclonal Antibody to Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 (CEACAM1)

Sign In for Pricing
View Details