Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF551 Peptide - N-terminal region

ZNF551 Peptide - N-terminal region

Product Specifications

UniProt

Q7Z340

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF551 Rabbit Polyclonal Antibody (orb577373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD96 Mouse mAb
63436 100 µL

CD96 Mouse mAb

Sign In for Pricing
View Details
PEG3 Rabbit Polyclonal Antibody (Cy3)
orb2584572 100 µg

PEG3 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
NFKB p65 Recombinant Antibody, PE Conjugated
bsm-33117R-PE 100 µL

NFKB p65 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Ubiquitin, Monoclonal Antibody, Mouse
MBS555092-01 0.1 mL

Ubiquitin, Monoclonal Antibody, Mouse

Sign In for Pricing
View Details
Ubiquitin, Monoclonal Antibody, Mouse
MBS555092-02 5x 0.1 mL

Ubiquitin, Monoclonal Antibody, Mouse

Sign In for Pricing
View Details
Recombinant Chloroplast envelope membrane protein (cemA)
MBS7011298-01 0.02 mg

Recombinant Chloroplast envelope membrane protein (cemA)

Sign In for Pricing
View Details