Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF551 Peptide - N-terminal region

ZNF551 Peptide - N-terminal region

Product Specifications

UniProt

Q7Z340

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF551 Rabbit Polyclonal Antibody (orb577373) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FEDVAIYFSQEEWELLDESQRFLYCDVMLENFAHVTSLGYCHGMENEAIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Receptor Subfamily 1, Group D, Member 2 (NR1D2) BioAssayTM ELISA Kit (Rat)
027197 96 Tests

Nuclear Receptor Subfamily 1, Group D, Member 2 (NR1D2) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Dienogest (DN)
MBS2141877-01 0.1 mL

HRP-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Dienogest (DN)
MBS2141877-02 0.2 mL

HRP-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Dienogest (DN)
MBS2141877-03 0.5 mL

HRP-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Dienogest (DN)
MBS2141877-04 1 mL

HRP-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Dienogest (DN)
MBS2141877-05 5 mL

HRP-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details