Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF707 Peptide - C-terminal region

ZNF707 Peptide - C-terminal region

Product Specifications

UniProt

Q96C28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF707 Rabbit Polyclonal Antibody (orb577392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776192

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ECGKSFRWPKGFSIHRRLHLTKRFYECGHCGKGFRHLGFFTRHQRTHRHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SRSF7 Protein, N-His-SUMO
orb3058593-01 50 µg

Recombinant Human SRSF7 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human SRSF7 Protein, N-His-SUMO
orb3058593-02 100 µg

Recombinant Human SRSF7 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human SRSF7 Protein, N-His-SUMO
orb3058593-03 1 mg

Recombinant Human SRSF7 Protein, N-His-SUMO

Sign In for Pricing
View Details
C1GALT1C1 siRNA Oligos set (Human)
14107171 3x 5 nmol

C1GALT1C1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Protein translocation protein SEC63 (SEC63)
MBS7029431-01 0.02 mg

Recombinant Saccharomyces cerevisiae Protein translocation protein SEC63 (SEC63)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Protein translocation protein SEC63 (SEC63)
MBS7029431-02 0.1 mg

Recombinant Saccharomyces cerevisiae Protein translocation protein SEC63 (SEC63)

Sign In for Pricing
View Details