U2AF1L4 Peptide - N-terminal region
U2AF1L4 Peptide - N-terminal region
Product Specifications
UniProt
Q8WU68
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with U2AF1L4 Rabbit Polyclonal Antibody (orb330114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KIGVCRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![APC Anti-Mouse CD115/CSF-1R Antibody[AFS98]](https://cdn.genprice.uk/products/763/68dd14ac061270361e7d2d9a/imageurl/e-ab-f1107e.webp)
E-AB-F1107E-01 50 Tests
APC Anti-Mouse CD115/CSF-1R Antibody[AFS98]
Sign In for Pricing
View Details E-AB-F1107E-02 100 Tests
APC Anti-Mouse CD115/CSF-1R Antibody[AFS98]
Sign In for Pricing
View Details E-AB-F1107E-03 2x 100 Tests
APC Anti-Mouse CD115/CSF-1R Antibody[AFS98]
Sign In for Pricing
View Details 
