Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX4 Peptide - middle region

NOX4 Peptide - middle region

Product Specifications

UniProt

E9PI95

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOX4 Rabbit Polyclonal Antibody (orb578136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGDDWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Irx6 3'UTR Luciferase Stable Cell Line
TU206392 1.0 mL

Irx6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
NDUFV1 Human Over-expression Lysate
orb1347335 100 µg

NDUFV1 Human Over-expression Lysate

Sign In for Pricing
View Details
DIRC1 Antibody
MBS7000342-01 0.05 mg

DIRC1 Antibody

Sign In for Pricing
View Details
DIRC1 Antibody
MBS7000342-02 0.1 mg

DIRC1 Antibody

Sign In for Pricing
View Details
DIRC1 Antibody
MBS7000342-03 5x 0.1 mg

DIRC1 Antibody

Sign In for Pricing
View Details
Porcine Calretinin Cr ELISA Kit
BG-POR10542 1 Each

Porcine Calretinin Cr ELISA Kit

Sign In for Pricing
View Details