NOX4 Peptide - middle region
NOX4 Peptide - middle region
Product Specifications
UniProt
E9PI95
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NOX4 Rabbit Polyclonal Antibody (orb578136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGDDWK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
B6797 96 Tests
Aryl-hydrocarbon-interacting protein-Like 1 (AIPL1) Bovine ELISA Kit
Sign In for Pricing
View Details 