Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN1 Peptide - middle region

ACTN1 Peptide - middle region

Product Specifications

UniProt

H9KV75

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTN1 Rabbit Polyclonal Antibody (orb578272) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNMGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laburnum anagyroides (Gold Chain) Immobilized lectin -LAL
A-8101-1 1 mL

Laburnum anagyroides (Gold Chain) Immobilized lectin -LAL

Sign In for Pricing
View Details
AP2A2 Rabbit Polyclonal Antibody
HA500477 100 µL

AP2A2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 (CR2) Mouse Monoclonal Antibody [Clone ID: OTI2D12]
CF814207 100 µg

CD21 (CR2) Mouse Monoclonal Antibody [Clone ID: OTI2D12]

Sign In for Pricing
View Details
IKBKE Rabbit Monoclonal Antibody
TA423824 100 µL

IKBKE Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF660C Conjugate, 0.1 mg/mL
BNC601331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), CF660C Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
BAP31 (BCAP31) (NM_001139441) Human Over-expression Lysate
LY427957 100 µg

BAP31 (BCAP31) (NM_001139441) Human Over-expression Lysate

Sign In for Pricing
View Details