Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTN1 Peptide - middle region

ACTN1 Peptide - middle region

Product Specifications

UniProt

H9KV75

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTN1 Rabbit Polyclonal Antibody (orb578272) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNMGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chrna7 activation kit by CRISPRa
GA200034 1 Kit

Mouse Chrna7 activation kit by CRISPRa

Sign In for Pricing
View Details
POTEE Human qPCR Primer Pair (NM_001083538)
HP230502 200 Reactions

POTEE Human qPCR Primer Pair (NM_001083538)

Sign In for Pricing
View Details
Peripherin Recombinant Rabbit monoclonal Antibody
HA723234 100 µL

Peripherin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF405S conjugate, 0.1mg/mL
BNC042470-100 1x 100 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2470), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fatty Acid Binding Protein 5 (FABP5) Human Gene Knockout Kit (CRISPR)
KN401973 1 Kit

Fatty Acid Binding Protein 5 (FABP5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
I-Sydnocarb
TRC-S920005-5MG 5 mg

I-Sydnocarb

Sign In for Pricing
View Details