Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE3C Peptide - N-terminal region

UBE3C Peptide - N-terminal region

Product Specifications

UniProt

Q15386

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE3C Rabbit Polyclonal Antibody (orb578745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFSFEGDFKTRPKVSLGGASRKYSIQRSAFDRCATLSQSGGAFPIANGPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF1B Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV698214 1.0 µg DNA

TNFRSF1B Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Caspase-12 Polyclonal Antibody, APC-Cy7 Conjugated
bs-1105R-APC-Cy7 100 µL

Caspase-12 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Platelet Basic Protein (PBP) Antibody
abx033475-01 80 µL

Platelet Basic Protein (PBP) Antibody

Sign In for Pricing
View Details
Platelet Basic Protein (PBP) Antibody
abx033475-02 400 µL

Platelet Basic Protein (PBP) Antibody

Sign In for Pricing
View Details
Hsa-miR-6862-5p agomir
HY-R02286A-01 5 nmol

Hsa-miR-6862-5p agomir

Sign In for Pricing
View Details
Hsa-miR-6862-5p agomir
HY-R02286A-02 20 nmol

Hsa-miR-6862-5p agomir

Sign In for Pricing
View Details