Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE3C Peptide - N-terminal region

UBE3C Peptide - N-terminal region

Product Specifications

UniProt

Q15386

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE3C Rabbit Polyclonal Antibody (orb578745) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MFSFEGDFKTRPKVSLGGASRKYSIQRSAFDRCATLSQSGGAFPIANGPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Colon: sigmoid
CP618174 150 µg

Tissue Protein Lysate, Colon: sigmoid

Sign In for Pricing
View Details
Anti-RPS20 Antibody
CPA7206-01 30 µL

Anti-RPS20 Antibody

Sign In for Pricing
View Details
Anti-RPS20 Antibody
CPA7206-02 50 μL

Anti-RPS20 Antibody

Sign In for Pricing
View Details
Anti-RPS20 Antibody
CPA7206-03 100 µL

Anti-RPS20 Antibody

Sign In for Pricing
View Details
Anti-RPS20 Antibody
CPA7206-04 200 µL

Anti-RPS20 Antibody

Sign In for Pricing
View Details
NCOAT (G-12) Alexa Fluor® 594
sc-376429 AF594 200 µg/mL

NCOAT (G-12) Alexa Fluor® 594

Sign In for Pricing
View Details