UBR2 Peptide - C-terminal region
UBR2 Peptide - C-terminal region
Product Specifications
UniProt
Q8IWV8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UBR2 Rabbit Polyclonal Antibody (orb330288) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDSKLW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH032380-01 10 µg
Recombinant Human ESAM Protein (aa 30-247, Fc Tag)
Sign In for Pricing
View Details PKSH032380-02 50 µg
Recombinant Human ESAM Protein (aa 30-247, Fc Tag)
Sign In for Pricing
View Details 
