Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPSNAP3B Peptide - N-terminal region

NIPSNAP3B Peptide - N-terminal region

Product Specifications

UniProt

F2Z3L7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NIPSNAP3B Rabbit Polyclonal Antibody (orb578906) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GPRQYDGTFYEFRTYYLKPSNMNAFMENLKKNIHLRTSYSELVGFWSVEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®555 Azide
#92081 1x 500 µg

CF®555 Azide

Sign In for Pricing
View Details
Human GGPS1 activation kit by CRISPRa
GA106313 1 Kit

Human GGPS1 activation kit by CRISPRa

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.10), CF740 conjugate, 0.1mg/mL
BNC740848-500 1x 500 µL

CD31 / PECAM-1 (C31.10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details