Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A8 Peptide - middle region

SLC26A8 Peptide - middle region

Product Specifications

UniProt

Q96RN1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC26A8 Rabbit Polyclonal Antibody (orb330363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr63 AAV siRNA Pooled Vector
33316164 1.0 µg

Olfr63 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TGIF2 (TGFB-Induced Factor Homeobox 2) (MaxLight 650)
252600-ML650 100 µL

TGIF2 (TGFB-Induced Factor Homeobox 2) (MaxLight 650)

Sign In for Pricing
View Details
RTI-13951-33 hydrochloride
HY-112612A-01 5 mg

RTI-13951-33 hydrochloride

Sign In for Pricing
View Details
RTI-13951-33 hydrochloride
HY-112612A-02 10 mM - 1 mL

RTI-13951-33 hydrochloride

Sign In for Pricing
View Details
RTI-13951-33 hydrochloride
HY-112612A-03 10 mg

RTI-13951-33 hydrochloride

Sign In for Pricing
View Details
RTI-13951-33 hydrochloride
HY-112612A-04 50 mg

RTI-13951-33 hydrochloride

Sign In for Pricing
View Details