Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A8 Peptide - middle region

SLC26A8 Peptide - middle region

Product Specifications

UniProt

Q96RN1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC26A8 Rabbit Polyclonal Antibody (orb330363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPYTVSSVSQKNQGQQYEEVEEVWLPNNSSRNSSPGLPDVAESQGRRSLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Zika Virus IgG Antibody [mFluor Violet 610 SE]
NBP2-61131MFV610 0.1 mL

Rabbit Polyclonal Zika Virus IgG Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal CBFB Antibody [mFluor Violet 500 SE]
NBP2-98895MFV500 0.1 mL

Rabbit Polyclonal CBFB Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
DCAF13 Protein Vector (Rat) (pPB-C-His)
PV263202 500 ng

DCAF13 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
5-Amino-4- (4-bromophenyl) isoxazole
261110-01 500 mg

5-Amino-4- (4-bromophenyl) isoxazole

Sign In for Pricing
View Details
5-Amino-4- (4-bromophenyl) isoxazole
261110-02 1 g

5-Amino-4- (4-bromophenyl) isoxazole

Sign In for Pricing
View Details
5-Amino-4- (4-bromophenyl) isoxazole
261110-03 2 g

5-Amino-4- (4-bromophenyl) isoxazole

Sign In for Pricing
View Details