ATP7A Peptide - middle region
ATP7A Peptide - middle region
Product Specifications
UniProt
Q04656
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP7A Rabbit Polyclonal Antibody (orb579085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942431-500 1x 500 µL
BAP1 (BRCA1 Associated Protein 1) (BAP1/2431), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC683604-500 1x 500 µL
CD79b (B-Cell Marker) (rIGB/1842), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 