Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP7A Peptide - middle region

ATP7A Peptide - middle region

Product Specifications

UniProt

Q04656

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP7A Rabbit Polyclonal Antibody (orb579085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822J-01 20 Tests

PerCP/Cyanine5.5 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822J-02 100 Tests

PerCP/Cyanine5.5 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG1, κ Isotype Control[HRPN]
E-AB-F09822J-03 2x 100 Tests

PerCP/Cyanine5.5 Rat IgG1, κ Isotype Control[HRPN]

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), 0.2mg/mL
BNUB2337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), 0.2mg/mL

Sign In for Pricing
View Details
Igfbp2 (NM_008342) Mouse Recombinant Protein
TP504287SE 20 µg

Igfbp2 (NM_008342) Mouse Recombinant Protein

Sign In for Pricing
View Details
Rat OC/BGP Antibody Pair Set
E-KAB-0627 50 µL & 100 µg

Rat OC/BGP Antibody Pair Set

Sign In for Pricing
View Details