GPD2 Peptide - N-terminal region
GPD2 Peptide - N-terminal region
Product Specifications
UniProt
F8W6E4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GPD2 Rabbit Polyclonal Antibody (orb579115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVDISESGLITI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400040-100 1x 100 µL
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details