Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDLR Peptide - C-terminal region

LDLR Peptide - C-terminal region

Product Specifications

Product Name Alternative

FH, FHC, LDLCQ2

UniProt

P01130

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LDLR Rabbit Polyclonal Antibody (orb579128) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001182732

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Podocin / PDCN (NPHS2) ELISA Kit
abx155992-01 96 Tests

Rat Podocin / PDCN (NPHS2) ELISA Kit

Sign In for Pricing
View Details
Rat Podocin / PDCN (NPHS2) ELISA Kit
abx155992-02 5x 96 Tests

Rat Podocin / PDCN (NPHS2) ELISA Kit

Sign In for Pricing
View Details
Rat Podocin / PDCN (NPHS2) ELISA Kit
abx155992-03 10x 96 Tests

Rat Podocin / PDCN (NPHS2) ELISA Kit

Sign In for Pricing
View Details
BCAS2 (Pre-mRNA-splicing Factor SPF27, Breast Carcinoma-amplified Sequence 2, DNA Amplified in Mammary Carcinoma 1 Protein, Spliceosome-associated Protein SPF 27, DAM1)
123869 100 µg

BCAS2 (Pre-mRNA-splicing Factor SPF27, Breast Carcinoma-amplified Sequence 2, DNA Amplified in Mammary Carcinoma 1 Protein, Spliceosome-associated Protein SPF 27, DAM1)

Sign In for Pricing
View Details
2-Acetamido-3-O- (D-1-carboxyethyl) -2-deoxy-2-D-glucose discontinued. See 239945
292364-01 25 mg

2-Acetamido-3-O- (D-1-carboxyethyl) -2-deoxy-2-D-glucose discontinued. See 239945

Sign In for Pricing
View Details
2-Acetamido-3-O- (D-1-carboxyethyl) -2-deoxy-2-D-glucose discontinued. See 239945
292364-02 50 mg

2-Acetamido-3-O- (D-1-carboxyethyl) -2-deoxy-2-D-glucose discontinued. See 239945

Sign In for Pricing
View Details