C4orf3 Peptide - C-terminal region
C4orf3 Peptide - C-terminal region
Product Specifications
UniProt
Q8WVX3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C4orf3 Rabbit Polyclonal Antibody (orb579160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001163801
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RFLGLLRSCRSEMEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680158-100 1x 100 µL
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040008-100 1x 100 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941037-500 1x 500 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680984-100 1x 100 µL
P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details