ANO9 Peptide - middle region
ANO9 Peptide - middle region
Product Specifications
UniProt
A1A5B4
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ANO9 Rabbit Polyclonal Antibody (orb579232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AIIMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR209456L4V 200 µL
Os9 (NM_177614) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
TL317681V 500 µL Each
MGC14859 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
Sign In for Pricing
View Details 
TRC-A575717-250G 250 g
Aluminum Oxide (Activated, Basic, Brockmann I)
Sign In for Pricing
View Details