Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO9 Peptide - middle region

ANO9 Peptide - middle region

Product Specifications

UniProt

A1A5B4

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANO9 Rabbit Polyclonal Antibody (orb579232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AIIMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LVA Antibody
orb1248708 0.1 mg

LVA Antibody

Sign In for Pricing
View Details
1,2,3,4,7,8-Hexachlorodibenzodioxin
sc-471444 5 mg

1,2,3,4,7,8-Hexachlorodibenzodioxin

Sign In for Pricing
View Details
Guinea Pig Free Immunoglobulin E ELISA kit
GTR14673050 96 Well

Guinea Pig Free Immunoglobulin E ELISA kit

Sign In for Pricing
View Details
SLCO4A1 Recombinant Protein Antigen
NBP1-80977PEP 0.1 mL

SLCO4A1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Human UL16 Binding Protein 3 (ALCAN-gamma) ELISA Kit
IHUULBP3KT 1 Each

Human UL16 Binding Protein 3 (ALCAN-gamma) ELISA Kit

Sign In for Pricing
View Details
Sgsm1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6457202 1.0 µg DNA

Sgsm1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details