Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NINL Peptide - middle region

NINL Peptide - middle region

Product Specifications

UniProt

Q9Y2I6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NINL Rabbit Polyclonal Antibody (orb579758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish TBP-1/PSMC3 Antibody Picoband® PE Conjugated
AZA0A0R4ILA8-PE 100 µg/Vial

Anti-Zebrafish TBP-1/PSMC3 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
RHOA Antibody
orb522059-01 50 μL

RHOA Antibody

Sign In for Pricing
View Details
RHOA Antibody
orb522059-02 100 µL

RHOA Antibody

Sign In for Pricing
View Details
Human Prohibitin (PHB) ELISA Kit
RD-PHB-Hu-96Tests 96 Tests

Human Prohibitin (PHB) ELISA Kit

Sign In for Pricing
View Details
Isovanillic acid
HY-N6864-01 5 mg

Isovanillic acid

Sign In for Pricing
View Details
Isovanillic acid
HY-N6864-02 10 mM - 1 mL

Isovanillic acid

Sign In for Pricing
View Details