NINL Peptide - middle region
NINL Peptide - middle region
Product Specifications
UniProt
Q9Y2I6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NINL Rabbit Polyclonal Antibody (orb579758) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLERAEKRNLEFVKEMDDCHSTLEQLTEKKIKHLEQGYRERLSLLRSEVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15384172 1 Vial
Lentiviral human DGAT2 sgRNA gene knockout kit - Lentiviral human DGAT2 sgRNA gene knockout kit (100)
Sign In for Pricing
View Details 
TMAC-01347-01 50 μL
Anti-Phospho-EPS15 (Tyr849) Polyclonal Antibody
Sign In for Pricing
View Details TMAC-01347-02 100 µL
Anti-Phospho-EPS15 (Tyr849) Polyclonal Antibody
Sign In for Pricing
View Details OR1103189-01 100 mg
2-Benzhydryl-5-oxa-2,8-diazaspiro[3.5]nonan-7-one
Sign In for Pricing
View Details