Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SV2B Peptide - C-terminal region

SV2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HsT19680

UniProt

Q7L1I2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SV2B Rabbit Polyclonal Antibody (orb579957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055663

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAdV-5 L3/CP-H/Protein II Polyclonal Antibody
E55A03097 100 µg

HAdV-5 L3/CP-H/Protein II Polyclonal Antibody

Sign In for Pricing
View Details
Fluorescein isothiocyanate isomer I, 97.5%
GT3648-1g 1 g

Fluorescein isothiocyanate isomer I, 97.5%

Sign In for Pricing
View Details
BMP4 Polyclonal Antibody, FITC Conjugated
A55461-050 50 µL

BMP4 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Lentiviral human KIR3DL3 sgRNA gene knockout kit - Lentiviral human KIR3DL3 sgRNA gene knockout kit (100)
GTR15358927 1 Vial

Lentiviral human KIR3DL3 sgRNA gene knockout kit - Lentiviral human KIR3DL3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Fam73b ORF Vector (Mouse) (pORF)
ORF044531 1.0 µg DNA

Fam73b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Sapcd2 Mouse shRNA Plasmid (Locus ID 72080)
TL517834 1 Kit

Sapcd2 Mouse shRNA Plasmid (Locus ID 72080)

Sign In for Pricing
View Details