Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SV2B Peptide - C-terminal region

SV2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HsT19680

UniProt

Q7L1I2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SV2B Rabbit Polyclonal Antibody (orb579957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055663

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TINFTMENQIHQHGKLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC12A1 / NKCC2 Recombinant Rabbit monoclonal Antibody
IRS181RB 50 Tests

SLC12A1 / NKCC2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ATF1 3'UTR GFP Stable Cell Line
TU051319 1.0 mL

ATF1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Interleukin 4, High Sensitivity ELISA Kit
MBS7273859-01 48 Well

Mouse Interleukin 4, High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 4, High Sensitivity ELISA Kit
MBS7273859-02 96 Well

Mouse Interleukin 4, High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 4, High Sensitivity ELISA Kit
MBS7273859-03 5x 96 Well

Mouse Interleukin 4, High Sensitivity ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 4, High Sensitivity ELISA Kit
MBS7273859-04 10x 96 Well

Mouse Interleukin 4, High Sensitivity ELISA Kit

Sign In for Pricing
View Details