MCTP2 Peptide - middle region
MCTP2 Peptide - middle region
Product Specifications
UniProt
Q6DN12
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MCTP2 Rabbit Polyclonal Antibody (orb580051) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IRTFTPREKRFVEDSRKLSKKILSRDVDRVKRITMAIWNTMQFLKSCFQW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A11791-1-Cy3 100 µg/Vial
Anti-SLC25A21 Antibody Picoband® Cy3 Conjugated
Sign In for Pricing
View Details 