Styk1 Peptide - middle region
Styk1 Peptide - middle region
Product Specifications
UniProt
Q6J9G1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Styk1 Rabbit Polyclonal Antibody (orb580064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YHIGKQILLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15331894 1 Vial
Lentiviral human GRHL2 shRNA (UAS) - Lentiviral human GRHL2 shRNA (UAS) plasmid
Sign In for Pricing
View Details TL707435V 500 µL Each
Cnfn Rat shRNA Lentiviral Particle (Locus ID 365217)
Sign In for Pricing
View Details bs-9044R-PE-Cy7 100 µL
TRPM7 Polyclonal Antibody, PE-Cy7 Conjugated
Sign In for Pricing
View Details 